PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr026136.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 509aa    MW: 57408.9 Da    PI: 7.1518
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr026136.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM113.91.7e-35612302128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkk...leleevikevdiykvePwdLpk........................................kvka... 53 
                  ppG rF Ptd+el+++yL++k+ ++     +++  i++++iy+++P++L                                          k      
  Pbr026136.1  61 PPGWRFCPTDQELISFYLTRKLMNNIyhpQPVNCRITDLHIYDFNPKKLAGlslslslslslshththahthartrtrhgctttmtcrvneK--Yqlp 156
                  9*********************9998665555445**************845899********************99999999888755542..0345 PP

          NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  e+ e+yfF++rd+ky++g r++r++++g+Wkatg +k++ + +g+++g k+tLvf+ g+++kg+ktdW+m+ey++
  Pbr026136.1 157 EDPEMYFFTPRDRKYPNGCRPSRTAADGFWKATGGNKNIRE-RGKTIGYKNTLVFFLGTQKKGTKTDWIMQEYTI 230
                  6669************************************9.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-1255113IPR003441NAC domain
PROSITE profilePS5100540.87860259IPR003441NAC domain
PfamPF023652.4E-2161230IPR003441NAC domain
SuperFamilySSF1019417.19E-29155257IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MASPSPNPTY SHSAPPAAAA LDGQEGGQQY HGHQHEHHHG RHDKEDPKQM MRNERLVLGI  60
PPGWRFCPTD QELISFYLTR KLMNNIYHPQ PVNCRITDLH IYDFNPKKLA GLSLSLSLSL  120
SLSHTHTHAH THARTRTRHG CTTTMTCRVN EKYQLPEDPE MYFFTPRDRK YPNGCRPSRT  180
AADGFWKATG GNKNIRERGK TIGYKNTLVF FLGTQKKGTK TDWIMQEYTI RKYQPSDSPA  240
PGDRDTKLDK WVLCKIYEHK KSKKNRKNGR VSDDDEDEIN SSAALVLQGQ ESQDHPLLHK  300
PLSPPRNNMN HDGPSTSYQA GQYNMINNNH SAYALNNGLM SPLESIYGHG AHQDQVRHLA  360
PMLHLPGQQV MQPIPLVHST NVNNQDGHAF NGIATYYNQS TQYGFGDQSV PMYNNASQLN  420
NNGYPSSIIS VDTMDQYWLN EPLTDFDFSF DAINEPLTDF DFSFDAIGEG VPFGMPDVLP  480
LSWMPHINPV SQSTKADEKS STTPTDNH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-355826215168NAC domain-containing protein 19
4dul_A6e-355826215168NAC domain-containing protein 19
1ut7_B6e-355826215168NO APICAL MERISTEM PROTEIN
1ut7_A6e-355826215168NO APICAL MERISTEM PROTEIN
1ut4_B6e-355826215168NO APICAL MERISTEM PROTEIN
1ut4_A6e-355826215168NO APICAL MERISTEM PROTEIN
3swp_D7e-355826218171NAC domain-containing protein 19
3swp_C7e-355826218171NAC domain-containing protein 19
3swp_B7e-355826218171NAC domain-containing protein 19
3swp_A7e-355826218171NAC domain-containing protein 19
3swm_D7e-355826218171NAC domain-containing protein 19
3swm_C7e-355826218171NAC domain-containing protein 19
3swm_B7e-355826218171NAC domain-containing protein 19
3swm_A7e-355826218171NAC domain-containing protein 19
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008392252.10.0PREDICTED: NAC domain-containing protein 43-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2051144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.13e-36NAC domain containing protein 3